Lineage for d2o3cc_ (2o3c C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044453Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1044454Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1044455Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 1044503Protein automated matches [190454] (2 species)
    not a true protein
  7. 1044509Species Zebrafish (Danio rerio) [TaxId:7955] [188298] (1 PDB entry)
  8. 1044512Domain d2o3cc_: 2o3c C: [166518]
    automated match to d1dewb_
    complexed with pb

Details for d2o3cc_

PDB Entry: 2o3c (more details), 2.3 Å

PDB Description: crystal structure of zebrafish ape
PDB Compounds: (C:) APEX nuclease 1

SCOPe Domain Sequences for d2o3cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o3cc_ d.151.1.1 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
pilyedppekltskdgraanmkitswnvdglrawvkkngldwvrkedpdilclqetkcae
kalpaditampeyphkywagsedkegysgvamlckteplnvtygigkeehdkegrvitae
fpdfflvtayvpnasrglvrldyrktwdvdfraylcgldarkplvlcgdlnvahqeidlk
npkgnrknagftpeeregftqlleagftdsfrelypdqayaytfwtymmnarsknvgwrl
dyfvlssallpglcdskirntamgsdhcpitlflav

SCOPe Domain Coordinates for d2o3cc_:

Click to download the PDB-style file with coordinates for d2o3cc_.
(The format of our PDB-style files is described here.)

Timeline for d2o3cc_: