SCOPe 2.04: Domain d2o3cb_: 2o3c B:

Lineage for d2o3cb_ (2o3c B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.1: DNase I-like [56220] (7 proteins)

6. Protein automated matches [190454] (2 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [188298] (1 PDB entry)

8. Domain d2o3cb_: 2o3c B: [166517]
   automated match to d1dewb_
   complexed with pb

Details for d2o3cb_

PDB Entry: 2o3c, 2.3 Å

PDB Description: crystal structure of zebrafish ape

PDB Compounds: (B:) APEX nuclease 1

SCOPe Domain Sequences for d2o3cb_:

Sequence; same for both SEQRES and ATOM records:

>d2o3cb_ d.151.1.1 (B:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
hmeapilyedppekltskdgraanmkitswnvdglrawvkkngldwvrkedpdilclqet
kcaekalpaditampeyphkywagsedkegysgvamlckteplnvtygigkeehdkegrv
itaefpdfflvtayvpnasrglvrldyrktwdvdfraylcgldarkplvlcgdlnvahqe
idlknpkgnrknagftpeeregftqlleagftdsfrelypdqayaytfwtymmnarsknv
gwrldyfvlssallpglcdskirntamgsdhcpitlflav

Timeline for d2o3cb_:

• d2o3cb_ first appeared in SCOPe 2.01
  
• d2o3cb_ appears in SCOPe 2.03
  
• d2o3cb_ appears in SCOPe 2.05
  
• d2o3cb_ appears in the current release, SCOPe 2.08, called d2o3cb1