Lineage for d2o36a_ (2o36 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034471Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1034472Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1034571Family d.92.1.5: Neurolysin-like [55505] (5 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 1034601Protein Neurolysin (endopeptidase 24.16, thimet oligopeptidase) [55506] (2 species)
    M3 family member; the thermolysin-like catalytic domain consists of residues 352-674
  7. 1034602Species Human (Homo sapiens) [TaxId:9606] [111081] (2 PDB entries)
    Uniprot P52888
  8. 1034603Domain d2o36a_: 2o36 A: [166514]
    automated match to d1i1ip_
    complexed with zn

Details for d2o36a_

PDB Entry: 2o36 (more details), 1.95 Å

PDB Description: crystal structure of engineered thimet oligopeptidase with neurolysin specificity in neurotensin cleavage site
PDB Compounds: (A:) Thimet oligopeptidase

SCOPe Domain Sequences for d2o36a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o36a_ d.92.1.5 (A:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Human (Homo sapiens) [TaxId: 9606]}
lrwdlsaqqieertrelieqtkrvydqvgtqefedvsyestlkaladvevtytvqrnild
fpqhvspskdirtasteadkklsefdvemsmredvyqrivwlqekvqkdslrpeaaryle
rliklgrrnglhlpretqenikrikkklsllcidfnknlnedttflpftlqelgglpedf
lnslekmedgklkvtlkyphyfpllkkchvpetrrkveeafnsrckeensailkelvtlr
aqksrllgfhthadyvlemnmaktsqtvatfldelaqklkplgeqeravilelkraecer
rglpfdgrirawdmryymnqveetrycvdqnllkeyfpvqvvthgllgiyqellglafhh
eegasawhedvrlytardaasgevvgkfyldlypregkyghaacfglqpgclrqdgsrqi
aiaamvanftkptadapsllqhdevrtyfhefghvmhqlcsqaefamfsgthvetdfvea
psqmlenwvweqepllrmsrhyrtgsavprellekliesrqantglfnlrqivlakvdqa
lhtqtdadpaeeyarlcqeilgvpatpgtnmpatfghlaggydaqyygylwsevysmdmf
htrfkqegvlnskvgmdyrscilrpggsedasamlrrflgrdpkqdafllskgl

SCOPe Domain Coordinates for d2o36a_:

Click to download the PDB-style file with coordinates for d2o36a_.
(The format of our PDB-style files is described here.)

Timeline for d2o36a_: