Lineage for d2o31a_ (2o31 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946224Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 946580Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 946581Protein automated matches [190457] (5 species)
    not a true protein
  7. 946601Species Human (Homo sapiens) [TaxId:9606] [187598] (8 PDB entries)
  8. 946605Domain d2o31a_: 2o31 A: [166513]
    automated match to d1oota_
    complexed with fmt

Details for d2o31a_

PDB Entry: 2o31 (more details), 1.5 Å

PDB Description: Crystal structure of the second SH3 domain from ponsin
PDB Compounds: (A:) Ponsin

SCOPe Domain Sequences for d2o31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o31a_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gidpftgeaiakfnfngdtqvemsfrkgeritllrqvdenwyegripgtsrqgifpityv
dvikrpl

SCOPe Domain Coordinates for d2o31a_:

Click to download the PDB-style file with coordinates for d2o31a_.
(The format of our PDB-style files is described here.)

Timeline for d2o31a_: