Lineage for d2o2zc_ (2o2z C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2152021Fold c.143: CofD-like [142337] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567; topological similarity to the CobT-like fold (52732)
  4. 2152022Superfamily c.143.1: CofD-like [142338] (2 families) (S)
  5. 2152023Family c.143.1.1: CofD-like [142339] (3 protein domains)
    Pfam PF01933; UPF0052
  6. 2152041Protein automated matches [190749] (1 species)
    not a true protein
  7. 2152042Species Bacillus halodurans [TaxId:86665] [187943] (1 PDB entry)
  8. 2152045Domain d2o2zc_: 2o2z C: [166511]
    Other proteins in same PDB: d2o2za2
    automated match to d2hzba1
    complexed with nad, so4

Details for d2o2zc_

PDB Entry: 2o2z (more details), 2.6 Å

PDB Description: crystal structure of a protein member of the upf0052 family (bh3568) from bacillus halodurans at 2.60 a resolution
PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d2o2zc_:

Sequence, based on SEQRES records: (download)

>d2o2zc_ c.143.1.1 (C:) automated matches {Bacillus halodurans [TaxId: 86665]}
kknvivfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnvlv
alseveplleqlfqhrfengnglsghslgnlllagmtsitgdfargisemskvlnvrgkv
lpasnrsiilhgemedgtivtgessipkagkkikrvfltpkdtkplregleairkadviv
igpgslytsvlpnllvpgiceaikqstarkvyicnvmtqngetdgytasdhlqaimdhcg
vgivddilvhgepisdtvkakyakekaepvivdehklkalgvgtisdyfvleqddvlrhn
askvseaile

Sequence, based on observed residues (ATOM records): (download)

>d2o2zc_ c.143.1.1 (C:) automated matches {Bacillus halodurans [TaxId: 86665]}
kknvivfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnvlv
alseveplleqlfqhrfengglsghslgnlllagmtsitgdfargisemskvlnvrgkvl
pasnrsiilhgemedgtivtgessipkagkkikrvfltpkdtkplregleairkadvivi
gpgslytsvlpnllvpgiceaikqstarkvyicnvmtqngetdgytasdhlqaimdhcgv
givddilvhgepisdtvkakyakekaepvivdehklkalgvgtisdyfvleqddvlrhna
skvseaile

SCOPe Domain Coordinates for d2o2zc_:

Click to download the PDB-style file with coordinates for d2o2zc_.
(The format of our PDB-style files is described here.)

Timeline for d2o2zc_: