SCOPe 2.05: Domain d2o2ia_: 2o2i A:

Lineage for d2o2ia_ (2o2i A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (4 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [188251] (3 PDB entries)

8. Domain d2o2ia_: 2o2i A: [166505]
   automated match to d1k5pa_
   complexed with br, pdo

Details for d2o2ia_

PDB Entry: 2o2i, 1.5 Å

PDB Description: Crystal structure of haloalkane dehalogenase Rv2579 from Mycobacterium tuberculosis complexed with 1,3-propandiol

PDB Compounds: (A:) Haloalkane dehalogenase 3

SCOPe Domain Sequences for d2o2ia_:

Sequence; same for both SEQRES and ATOM records:

>d2o2ia_ c.69.1.8 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
fgvepygqpkyleiagkrmayidegkgdaivfqhgnptssylwrnimphleglgrlvacd
ligmgasdklspsgpdrysygeqrdflfalwdaldlgdhvvlvlhdwgsalgfdwanqhr
drvqgiafmeaivtpmtwadwppavrgvfqgfrspqgepmalehnifvervlpgailrql
sdeemnhyrrpfvnggedrrptlswprnlpidgepaevvalvneyrswleetdmpklfin
aepgaiitgrirdyvrswpnqteitvpgvhfvqedspeeigaaiaqfvrrlrs

Timeline for d2o2ia_:

• d2o2ia_ first appeared in SCOPe 2.01
  
• d2o2ia_ appears in SCOPe 2.04
  
• d2o2ia_ appears in SCOPe 2.06
  
• d2o2ia_ appears in the current release, SCOPe 2.08