SCOPe 2.08: Domain d2o2ba1: 2o2b A:1002-1230

Lineage for d2o2ba1 (2o2b A:1002-1230)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d2o2ba1: 2o2b A:1002-1230 [166503]
   Other proteins in same PDB: d2o2ba2
   automated match to d1qyoa_
   complexed with iod

Details for d2o2ba1

PDB Entry: 2o2b, 1.94 Å

PDB Description: spectroscopic and structural study of the heterotropic linkage between halide and proton ion binding to gfp proteins: e2(gfp)-i complex

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d2o2ba1:

Sequence; same for both SEQRES and ATOM records:

>d2o2ba1 d.22.1.1 (A:1002-1230) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagit

Timeline for d2o2ba1:

• d2o2ba1 first appeared in SCOPe 2.01, called d2o2ba_
  
• d2o2ba1 appears in SCOPe 2.07