SCOPe 2.07: Domain d2o27b_: 2o27 B:

Lineage for d2o27b_ (2o27 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187941] (5 PDB entries)

8. Domain d2o27b_: 2o27 B: [166501]
   automated match to d1exzb_

Details for d2o27b_

PDB Entry: 2o27, 2.2 Å

PDB Description: Structure of a class III RTK signaling assembly

PDB Compounds: (B:) Kit ligand

SCOPe Domain Sequences for d2o27b_:

Sequence, based on SEQRES records:

>d2o27b_ a.26.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldkfsnise
glsnysiidklgkivddlvlcmeenapknikespkrpetrsftpeeffsifnrsidafkd
fmvasdtsdcvls

Sequence, based on observed residues (ATOM records):

>d2o27b_ a.26.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldkfsnise
glsnysiidklgkivddlvlcmeenapknispkrpetrsftpeeffsifnrsidafkdfm
dcvls

Timeline for d2o27b_:

• d2o27b_ first appeared in SCOPe 2.01
  
• d2o27b_ appears in SCOPe 2.06
  
• d2o27b_ appears in the current release, SCOPe 2.08