Lineage for d2o27a_ (2o27 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705721Protein automated matches [190501] (4 species)
    not a true protein
  7. 2705763Species Mouse (Mus musculus) [TaxId:10090] [187941] (5 PDB entries)
  8. 2705764Domain d2o27a_: 2o27 A: [166500]
    automated match to d1exzb_

Details for d2o27a_

PDB Entry: 2o27 (more details), 2.2 Å

PDB Description: Structure of a class III RTK signaling assembly
PDB Compounds: (A:) Kit ligand

SCOPe Domain Sequences for d2o27a_:

Sequence, based on SEQRES records: (download)

>d2o27a_ a.26.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cgnpvtdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldkf
sniseglsnysiidklgkivddlvlcmeenapknikespkrpetrsftpeeffsifnrsi
dafkdfmvasdtsdcvls

Sequence, based on observed residues (ATOM records): (download)

>d2o27a_ a.26.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cgnnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldkfsnis
eglsnysiidklgkivddlvlcmeenapknispkrpetrsftpeeffsifnrsidafkdf
sdcvls

SCOPe Domain Coordinates for d2o27a_:

Click to download the PDB-style file with coordinates for d2o27a_.
(The format of our PDB-style files is described here.)

Timeline for d2o27a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2o27b_