SCOPe 2.06: Domain d2o26e_: 2o26 E:

Lineage for d2o26e_ (2o26 E:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187941] (5 PDB entries)

8. Domain d2o26e_: 2o26 E: [166498]
   Other proteins in same PDB: d2o26a2
   automated match to d1exzb_

Details for d2o26e_

PDB Entry: 2o26, 2.5 Å

PDB Description: structure of a class iii rtk signaling assembly

PDB Compounds: (E:) Kit ligand

SCOPe Domain Sequences for d2o26e_:

Sequence; same for both SEQRES and ATOM records:

>d2o26e_ a.26.1.2 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
icgnpvtdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldk
fsniseglsnysiidklgkivddlvlcmeenapknikespkrpetrsftpeeffsifnrs
idafkdfmvasdtsdcvls

Timeline for d2o26e_:

• d2o26e_ first appeared in SCOPe 2.01
  
• d2o26e_ appears in SCOPe 2.05
  
• d2o26e_ appears in SCOPe 2.07
  
• d2o26e_ appears in the current release, SCOPe 2.08