Lineage for d2o26b_ (2o26 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705721Protein automated matches [190501] (4 species)
    not a true protein
  7. 2705763Species Mouse (Mus musculus) [TaxId:10090] [187941] (5 PDB entries)
  8. 2705773Domain d2o26b_: 2o26 B: [166497]
    Other proteins in same PDB: d2o26a2
    automated match to d1exzb_

Details for d2o26b_

PDB Entry: 2o26 (more details), 2.5 Å

PDB Description: structure of a class iii rtk signaling assembly
PDB Compounds: (B:) Kit ligand

SCOPe Domain Sequences for d2o26b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o26b_ a.26.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
icgnpvtdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldk
fsniseglsnysiidklgkivddlvlcmeenapknikespkrpetrsftpeeffsifnrs
idafkdfmvasdtsdcvls

SCOPe Domain Coordinates for d2o26b_:

Click to download the PDB-style file with coordinates for d2o26b_.
(The format of our PDB-style files is described here.)

Timeline for d2o26b_: