![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein automated matches [190501] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187941] (5 PDB entries) |
![]() | Domain d2o26a1: 2o26 A:3-141 [166496] Other proteins in same PDB: d2o26a2 automated match to d1exzb_ |
PDB Entry: 2o26 (more details), 2.5 Å
SCOPe Domain Sequences for d2o26a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o26a1 a.26.1.2 (A:3-141) automated matches {Mouse (Mus musculus) [TaxId: 10090]} icgnpvtdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldk fsniseglsnysiidklgkivddlvlcmeenapknikespkrpetrsftpeeffsifnrs idafkdfmvasdtsdcvls
Timeline for d2o26a1: