Lineage for d2o24a1 (2o24 A:1002-1237)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2164737Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 2164743Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (175 PDB entries)
    Uniprot P42212
  8. 2164790Domain d2o24a1: 2o24 A:1002-1237 [166495]
    Other proteins in same PDB: d2o24a2
    automated match to d1qyoa_
    complexed with cl

Details for d2o24a1

PDB Entry: 2o24 (more details), 1.45 Å

PDB Description: Spectroscopic and Structural Study of the Heterotropic Linkage between Halide and Proton Ion Binding to Gfp Proteins: E2(GFP)-Cl Complex
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d2o24a1:

Sequence, based on SEQRES records: (download)

>d2o24a1 d.22.1.1 (A:1002-1237) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitlgmdely

Sequence, based on observed residues (ATOM records): (download)

>d2o24a1 d.22.1.1 (A:1002-1237) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitely

SCOPe Domain Coordinates for d2o24a1:

Click to download the PDB-style file with coordinates for d2o24a1.
(The format of our PDB-style files is described here.)

Timeline for d2o24a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o24a2