Lineage for d2o1ga1 (2o1g A:64-345)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133477Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 protein domains)
    automatically mapped to Pfam PF03414
  6. 2133579Protein Glycosyltransferase B [75278] (1 species)
    involved in blood group antigen biosynthesis
  7. 2133580Species Human (Homo sapiens) [TaxId:9606] [75279] (13 PDB entries)
  8. 2133586Domain d2o1ga1: 2o1g A:64-345 [166491]
    Other proteins in same PDB: d2o1ga2
    automated match to d1lz7a_
    complexed with hg; mutant

Details for d2o1ga1

PDB Entry: 2o1g (more details), 1.71 Å

PDB Description: natural occurring mutant of human abo(h) galactosyltransferase: gtb/m214t
PDB Compounds: (A:) ABO glycosyltransferase

SCOPe Domain Sequences for d2o1ga1:

Sequence, based on SEQRES records: (download)

>d2o1ga1 c.68.1.9 (A:64-345) Glycosyltransferase B {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdtefrdhvgveiltplfgtlhpsfygssrea
ftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp

Sequence, based on observed residues (ATOM records): (download)

>d2o1ga1 c.68.1.9 (A:64-345) Glycosyltransferase B {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevcerrflse
vdylvcvdvdtefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdegdf
yymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspey
lwdqqllgwpavlrklrftavp

SCOPe Domain Coordinates for d2o1ga1:

Click to download the PDB-style file with coordinates for d2o1ga1.
(The format of our PDB-style files is described here.)

Timeline for d2o1ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o1ga2