Class a: All alpha proteins [46456] (258 folds) |
Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Bacterioferritin (cytochrome b1) [47244] (4 species) binds heme between two subunits; 24-mer |
Species Escherichia coli [TaxId:562] [47245] (3 PDB entries) |
Domain d1bcfb_: 1bcf B: [16649] complexed with hem, mn |
PDB Entry: 1bcf (more details), 2.9 Å
SCOP Domain Sequences for d1bcfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bcfb_ a.25.1.1 (B:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]} mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm ieilrdeeghidwleteldliqkmglqnylqaqireeg
Timeline for d1bcfb_: