SCOP 1.65: Domain d1bcfb_: 1bcf B:

Lineage for d1bcfb_ (1bcf B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)
   contains dimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (5 proteins)

6. Protein Bacterioferritin (cytochrome b1) [47244] (3 species)
   binds haem between two subunits; 24-mer

7. Species Escherichia coli [TaxId:562] [47245] (2 PDB entries)

8. Domain d1bcfb_: 1bcf B: [16649]
   complexed with hem, mn

Details for d1bcfb_

PDB Entry: 1bcf, 2.9 Å

PDB Description: the structure of a unique, two-fold symmetric, haem-binding site

SCOP Domain Sequences for d1bcfb_:

Sequence; same for both SEQRES and ATOM records:

>d1bcfb_ a.25.1.1 (B:) Bacterioferritin (cytochrome b1) {Escherichia coli}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

Timeline for d1bcfb_:

• d1bcfb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bcfb_ appears in SCOP 1.63
  
• d1bcfb_ appears in SCOP 1.67
  
• d1bcfb_ appears in the current release, SCOPe 2.08