Lineage for d2o0rb1 (2o0r B:2-392)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132753Species Mycobacterium tuberculosis [TaxId:83332] [187938] (7 PDB entries)
  8. 2132757Domain d2o0rb1: 2o0r B:2-392 [166483]
    Other proteins in same PDB: d2o0ra2, d2o0rb2
    automated match to d1u08a_
    complexed with cl, gol, na

Details for d2o0rb1

PDB Entry: 2o0r (more details), 2 Å

PDB Description: the three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis
PDB Compounds: (B:) Rv0858c (N-Succinyldiaminopimelate aminotransferase)

SCOPe Domain Sequences for d2o0rb1:

Sequence, based on SEQRES records: (download)

>d2o0rb1 c.67.1.0 (B:2-392) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tvsrlrpyattvfaemsalatrigavnlgqgfpdedgppkmlqaaqdaiaggvnqyppgp
gsaplrraiaaqrrrhfgvdydpetevlvtvgateaiaaavlglvepgsevlliepfyds
yspvvamagahrvtvplvpdgrgfaldadalrravtprtraliinsphnptgavlsatel
aaiaeiavaanlvvitdevyehlvfdharhlplagfdgmaertitissaakmfnctgwki
gwacgpaeliagvraakqylsyvggapfqpavalaldtedawvaalrnslrarrdrlaag
lteigfavhdsygtyflcadprplgyddstefcaalpekvgvaaipmsafcdpaagqasq
qadvwnhlvrftfckrddtldeairrlsvla

Sequence, based on observed residues (ATOM records): (download)

>d2o0rb1 c.67.1.0 (B:2-392) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tvsrlrpyattvfaemsalatrigavnlgqgfpdedgppkmlqaaqdaiaggvnqyppgp
gsaplrraiaaqrrrhfgvdydpetevlvtvgateaiaaavlglvepgsevlliepfyds
yspvvamagahrvtvplvpdgrgfaldadalrravtprtraliinsphnptgavlsatel
aaiaeiavaanlvvitdevyehlvfdharhlplagfdgmaertitissaakmfnctgwki
gwacgpaeliagvraakqylsyvggapfqpavalaldtedawvaalrnslrarrdrlaag
lteigfavhdsygtyflcadprplgyddstefcaalpekvgvaaipmsafcdpadvwnhl
vrftfckrddtldeairrlsvla

SCOPe Domain Coordinates for d2o0rb1:

Click to download the PDB-style file with coordinates for d2o0rb1.
(The format of our PDB-style files is described here.)

Timeline for d2o0rb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o0rb2