SCOPe 2.01: Domain d2o04a_: 2o04 A:

Lineage for d2o04a_ (2o04 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.1: Pectin lyase-like [51126] (12 families)
   superhelix turns are made of 3 strands each

5. Family b.80.1.1: Pectate lyase-like [51127] (3 proteins)
   this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain

6. Protein automated matches [190887] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188279] (7 PDB entries)

8. Domain d2o04a_: 2o04 A: [166481]
   automated match to d1bn8a_
   complexed with ca

Details for d2o04a_

PDB Entry: 2o04, 1.7 Å

PDB Description: pectate lyase bound to hexasaccharide compound ii

PDB Compounds: (A:) pectate lyase

SCOPe Domain Sequences for d2o04a_:

Sequence; same for both SEQRES and ATOM records:

>d2o04a_ b.80.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
adlghqtlgsndgwgaystgttggskasssnvytvsnrnqlvsalgketnttpkiiyikg
tidmnvddnlkplglndykdpeydldkylkaydpstwgkkepsgtqeeararsqknqkar
vmvdipanttivgsgtnakvvggnfqiksdnviirniefqdaydyfpqwdptdgssgnwn
sqydnitinggthiwidhctfndgsrpdstspkyygrkyqhhdgqtdasnganyitmsyn
yyhdhdkssifgssdsktsddgklkitlhhnryknivqaaprvrfgqvhvynnyyegsts
sssypfsyawgigksskiyaqnnvidvpglsaaktisvfsggtalydsgtllngtqinas
aanglsssvgwtpslhgsidasanvksnvinqagagkln

Timeline for d2o04a_:

• d2o04a_ is new in SCOPe 2.01-stable
  
• d2o04a_ appears in SCOPe 2.02
  
• d2o04a_ appears in the current release, SCOPe 2.08