SCOPe 2.08: Domain d2o03a1: 2o03 A:3-130

Lineage for d2o03a1 (2o03 A:3-130)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries)

8. Domain d2o03a1: 2o03 A:3-130 [166480]
   Other proteins in same PDB: d2o03a2
   automated match to d1mzba_
   complexed with zn

Details for d2o03a1

PDB Entry: 2o03, 2.7 Å

PDB Description: crystal structure of furb from m. tuberculosis- a zinc uptake regulator

PDB Compounds: (A:) probable Zinc uptake regulation protein FurB

SCOPe Domain Sequences for d2o03a1:

Sequence; same for both SEQRES and ATOM records:

>d2o03a1 a.4.5.0 (A:3-130) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
saagvrstrqraaistlletlddfrsaqelhdelrrrgeniglttvyrtlqsmassglvd
tlhtdtgesvyrrcsehhhhhlvcrscgstievgdheveawaaevatkhgfsdvshtiei
fgtcsdcr

Timeline for d2o03a1:

• d2o03a1 first appeared in SCOPe 2.01, called d2o03a_
  
• d2o03a1 appears in SCOPe 2.07