SCOPe 2.04: Domain d2nzod_: 2nzo D:

Lineage for d2nzod_ (2nzo D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (22 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187937] (2 PDB entries)

8. Domain d2nzod_: 2nzo D: [166479]
   automated match to d1gd7a_
   complexed with gol

Details for d2nzod_

PDB Entry: 2nzo, 2 Å

PDB Description: Crystal structure of a secretion chaperone CsaA from Bacillus subtilis in the space group P 32 2 1

PDB Compounds: (D:) Protein csaA

SCOPe Domain Sequences for d2nzod_:

Sequence; same for both SEQRES and ATOM records:

>d2nzod_ b.40.4.0 (D:) automated matches {Bacillus subtilis [TaxId: 1423]}
hmaviddfekldirtgtivkaeefpearvpaiklvidfgteigikqssaqitkrykpegl
inkqviavvnfpprriagfksevlvlggipgqgdvvllqpdqpvpngtkig

Timeline for d2nzod_:

• d2nzod_ first appeared in SCOPe 2.01
  
• d2nzod_ appears in SCOPe 2.03
  
• d2nzod_ appears in SCOPe 2.05
  
• d2nzod_ appears in the current release, SCOPe 2.08, called d2nzod1