Lineage for d2nzod_ (2nzo D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 950107Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 951085Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 951086Protein automated matches [190576] (5 species)
    not a true protein
  7. 951090Species Bacillus subtilis [TaxId:1423] [187937] (2 PDB entries)
  8. 951096Domain d2nzod_: 2nzo D: [166479]
    automated match to d1gd7a_
    complexed with gol

Details for d2nzod_

PDB Entry: 2nzo (more details), 2 Å

PDB Description: Crystal structure of a secretion chaperone CsaA from Bacillus subtilis in the space group P 32 2 1
PDB Compounds: (D:) Protein csaA

SCOPe Domain Sequences for d2nzod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nzod_ b.40.4.0 (D:) automated matches {Bacillus subtilis [TaxId: 1423]}
hmaviddfekldirtgtivkaeefpearvpaiklvidfgteigikqssaqitkrykpegl
inkqviavvnfpprriagfksevlvlggipgqgdvvllqpdqpvpngtkig

SCOPe Domain Coordinates for d2nzod_:

Click to download the PDB-style file with coordinates for d2nzod_.
(The format of our PDB-style files is described here.)

Timeline for d2nzod_: