![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
![]() | Protein automated matches [190576] (22 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [187937] (2 PDB entries) |
![]() | Domain d2nzoc_: 2nzo C: [166478] automated match to d1gd7a_ complexed with gol |
PDB Entry: 2nzo (more details), 2 Å
SCOPe Domain Sequences for d2nzoc_:
Sequence, based on SEQRES records: (download)
>d2nzoc_ b.40.4.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]} maviddfekldirtgtivkaeefpearvpaiklvidfgteigikqssaqitkrykpegli nkqviavvnfpprriagfksevlvlggipgqgdvvllqpdqpvpngtkig
>d2nzoc_ b.40.4.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]} maviddfekldirtgtivkaeefpaiklvidfgteigikqssaqitkrykpeglinkqvi avvnfpprriagfksevlvlggipgqgdvvllqpdqpvpngtkig
Timeline for d2nzoc_: