Lineage for d2nzob_ (2nzo B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1542164Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1542165Protein automated matches [190576] (22 species)
    not a true protein
  7. 1542180Species Bacillus subtilis [TaxId:1423] [187937] (2 PDB entries)
  8. 1542184Domain d2nzob_: 2nzo B: [166477]
    automated match to d1gd7a_
    complexed with gol

Details for d2nzob_

PDB Entry: 2nzo (more details), 2 Å

PDB Description: Crystal structure of a secretion chaperone CsaA from Bacillus subtilis in the space group P 32 2 1
PDB Compounds: (B:) Protein csaA

SCOPe Domain Sequences for d2nzob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nzob_ b.40.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
hmaviddfekldirtgtivkaeefpearvpaiklvidfgteigikqssaqitkrykpegl
inkqviavvnfpprriagfksevlvlggipgqgdvvllqpdqpvpngtkig

SCOPe Domain Coordinates for d2nzob_:

Click to download the PDB-style file with coordinates for d2nzob_.
(The format of our PDB-style files is described here.)

Timeline for d2nzob_: