Lineage for d2nzeb_ (2nze B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937671Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1937672Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1937673Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1937674Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 1937687Species Bacillus cereus [TaxId:1396] [56284] (23 PDB entries)
    Uniprot P04190 31-257
  8. 1937702Domain d2nzeb_: 2nze B: [166467]
    automated match to d1dxka_
    complexed with acy, gol, so4, zn; mutant

Details for d2nzeb_

PDB Entry: 2nze (more details), 1.8 Å

PDB Description: structure of beta-lactamase ii from bacillus cereus. r121h, c221s double mutant. space group p3121.
PDB Compounds: (B:) beta-lactamase II

SCOPe Domain Sequences for d2nzeb_:

Sequence, based on SEQRES records: (download)

>d2nzeb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
ktviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltk
eliemvekkfqkrvtdviithahadhiggiktlkergikahstaltaelakkngyeeplg
dlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggslvkstsakdlgnvaday
vnewstsienvlkryrninavvpghgevgdkglllhtldllk

Sequence, based on observed residues (ATOM records): (download)

>d2nzeb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
ktviknetgtisisqlnknvwvhtelgavpsnglvlntskglvlvdsswddkltkeliem
vekkfqkrvtdviithahadhiggiktlkergikahstaltaelakkngyeeplgdlqtv
tnlkfgnmkvetfypgkghtednivvwlpqynilvggslvkstsakdlgnvadayvnews
tsienvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d2nzeb_:

Click to download the PDB-style file with coordinates for d2nzeb_.
(The format of our PDB-style files is described here.)

Timeline for d2nzeb_: