Lineage for d2nzaa1 (2nza A:13-407)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005512Species Streptomyces coelicolor [TaxId:100226] [187338] (8 PDB entries)
  8. 2005522Domain d2nzaa1: 2nza A:13-407 [166464]
    Other proteins in same PDB: d2nzaa2, d2nzab2
    automated match to d1s1fa_
    complexed with hem

Details for d2nzaa1

PDB Entry: 2nza (more details), 2.9 Å

PDB Description: Structure and Function Studies of Cytochrome P450 158A1 from Streptomyces coelicolor A3(2)
PDB Compounds: (A:) Cytochrome P450 CYP158A1

SCOPe Domain Sequences for d2nzaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nzaa1 a.104.1.1 (A:13-407) automated matches {Streptomyces coelicolor [TaxId: 100226]}
pppvrdwpaldldgpefdpvlaelmregpltrvrlphgegwawlatryddvkaitndprf
graevtqrqitrlaphfkprpgslafadqpdhnrlrravagaftvgatkrlrpraqeild
glvdgilaegppadlvervlepfpiavvsevmgvpaadrervhswtrqiistsggaeaae
rakrglygwitetvraragseggdvysmlgaavgrgevgeteavglagplqiggeavthn
vgqmlyllltrrelmarmrerpgargtaldellrwishrtsvglarialedvevhgtria
agepvyvsylaanrdpdvfpdpdridldrdpnphlaygnghhfctgavlarmqtellvdt
llerlpglrlavpaeqvawrrktmirgprtlpctw

SCOPe Domain Coordinates for d2nzaa1:

Click to download the PDB-style file with coordinates for d2nzaa1.
(The format of our PDB-style files is described here.)

Timeline for d2nzaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nzaa2