Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein automated matches [190068] (12 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [187338] (8 PDB entries) |
Domain d2nz5b1: 2nz5 B:13-407 [166463] Other proteins in same PDB: d2nz5a2, d2nz5b2 automated match to d1s1fa_ complexed with 226, hem |
PDB Entry: 2nz5 (more details), 2.35 Å
SCOPe Domain Sequences for d2nz5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nz5b1 a.104.1.1 (B:13-407) automated matches {Streptomyces coelicolor [TaxId: 100226]} pppvrdwpaldldgpefdpvlaelmregpltrvrlphgegwawlatryddvkaitndprf graevtqrqitrlaphfkprpgslafadqpdhnrlrravagaftvgatkrlrpraqeild glvdgilaegppadlvervlepfpiavvsevmgvpaadrervhswtrqiistsggaeaae rakrglygwitetvraragseggdvysmlgaavgrgevgeteavglagplqiggeavthn vgqmlyllltrrelmarmrerpgargtaldellrwishrtsvglarialedvevhgtria agepvyvsylaanrdpdvfpdpdridldrdpnphlaygnghhfctgavlarmqtellvdt llerlpglrlavpaeqvawrrktmirgprtlpctw
Timeline for d2nz5b1: