SCOPe 2.05: Domain d2nyva_: 2nyv A:

Lineage for d2nyva_ (2nyv A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (49 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [187934] (1 PDB entry)

8. Domain d2nyva_: 2nyv A: [166461]
   automated match to d2hsza1

Details for d2nyva_

PDB Entry: 2nyv, 2.1 Å

PDB Description: x-ray crystal structure of a phosphoglycolate phosphatase from aquifex aeolicus

PDB Compounds: (A:) Phosphoglycolate phosphatase

SCOPe Domain Sequences for d2nyva_:

Sequence; same for both SEQRES and ATOM records:

>d2nyva_ c.108.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
mslrvilfdldgtlidsakdialalektlkelgleeyypdnvtkyigggvrallekvlkd
kfreeyvevfrkhylenpvvytkpypeipytlealkskgfklavvsnkleelskkildil
nlsgyfdlivggdtfgekkpsptpvlktleilgeepekalivgdtdadieagkragtkta
lalwgyvklnsqipdftlsrpsdlvklmdnhivefeg

Timeline for d2nyva_:

• d2nyva_ first appeared in SCOPe 2.01
  
• d2nyva_ appears in SCOPe 2.04
  
• d2nyva_ is called d2nyva1 in SCOPe 2.06
  
• d2nyva_ appears in the current release, SCOPe 2.08, called d2nyva1