Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (49 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187871] (11 PDB entries) |
Domain d2nyub_: 2nyu B: [166460] automated match to d1eiza_ protein/RNA complex; complexed with sam |
PDB Entry: 2nyu (more details), 1.76 Å
SCOPe Domain Sequences for d2nyub_:
Sequence, based on SEQRES records: (download)
>d2nyub_ c.66.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} syrsrsafkllevnerhqilrpglrvldcgaapgawsqvavqkvnaagtdpsspvgfvlg vdllhifplegatflcpadvtdprtsqrilevlpgrradvilsdmapnatgfrdldhdrl islcltllsvtpdilqpggtflcktwagsqsrrlqrrlteefqnvriikpeasrkessev yflatqyhg
>d2nyub_ c.66.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} syrsrsafkllevnerhqilrpglrvldcgaapgawsqvavqkvnaagtdpsspvgfvlg vdllhifplegatflcpadvtdprtsqrilevlpgrradvilsdmapnatgfrdldhdrl islcltllsvtpdilqpggtflcktwagsqsrrlqrrlteefqnvriikssevyflatqy hg
Timeline for d2nyub_: