Lineage for d2nyub_ (2nyu B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865706Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1865707Protein automated matches [190689] (49 species)
    not a true protein
  7. 1865811Species Human (Homo sapiens) [TaxId:9606] [187871] (11 PDB entries)
  8. 1865822Domain d2nyub_: 2nyu B: [166460]
    automated match to d1eiza_
    protein/RNA complex; complexed with sam

Details for d2nyub_

PDB Entry: 2nyu (more details), 1.76 Å

PDB Description: crystal structure of human ftsj homolog 2 (e.coli) protein in complex with s-adenosylmethionine
PDB Compounds: (B:) Putative ribosomal RNA methyltransferase 2

SCOPe Domain Sequences for d2nyub_:

Sequence, based on SEQRES records: (download)

>d2nyub_ c.66.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syrsrsafkllevnerhqilrpglrvldcgaapgawsqvavqkvnaagtdpsspvgfvlg
vdllhifplegatflcpadvtdprtsqrilevlpgrradvilsdmapnatgfrdldhdrl
islcltllsvtpdilqpggtflcktwagsqsrrlqrrlteefqnvriikpeasrkessev
yflatqyhg

Sequence, based on observed residues (ATOM records): (download)

>d2nyub_ c.66.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syrsrsafkllevnerhqilrpglrvldcgaapgawsqvavqkvnaagtdpsspvgfvlg
vdllhifplegatflcpadvtdprtsqrilevlpgrradvilsdmapnatgfrdldhdrl
islcltllsvtpdilqpggtflcktwagsqsrrlqrrlteefqnvriikssevyflatqy
hg

SCOPe Domain Coordinates for d2nyub_:

Click to download the PDB-style file with coordinates for d2nyub_.
(The format of our PDB-style files is described here.)

Timeline for d2nyub_: