Lineage for d1ryt_1 (1ryt 2-147)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46712Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 46713Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 46714Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 46826Protein Rubrerythrin, N-terminal domain [47242] (1 species)
  7. 46827Species Desulfovibrio vulgaris [TaxId:881] [47243] (3 PDB entries)
  8. 46829Domain d1ryt_1: 1ryt 2-147 [16646]
    Other proteins in same PDB: d1ryt_2

Details for d1ryt_1

PDB Entry: 1ryt (more details), 2.1 Å

PDB Description: rubrerythrin

SCOP Domain Sequences for d1ryt_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryt_1 a.25.1.1 (2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv

SCOP Domain Coordinates for d1ryt_1:

Click to download the PDB-style file with coordinates for d1ryt_1.
(The format of our PDB-style files is described here.)

Timeline for d1ryt_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ryt_2