![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
![]() | Protein automated matches [190059] (14 species) not a true protein |
![]() | Species Tribolium castaneum [TaxId:7070] [188215] (1 PDB entry) |
![]() | Domain d2nxxf_: 2nxx F: [166453] automated match to d1r20d_ complexed with p1a |
PDB Entry: 2nxx (more details), 2.75 Å
SCOPe Domain Sequences for d2nxxf_:
Sequence, based on SEQRES records: (download)
>d2nxxf_ a.123.1.1 (F:) automated matches {Tribolium castaneum [TaxId: 7070]} ispeqeelihrlvyfqneyehpseedvkriinqpmdgedqcdvrfrhiteitiltvqliv efakrlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqpysrdsynla gmgetiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiqeiylealra yvdnrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflaeiwdvd
>d2nxxf_ a.123.1.1 (F:) automated matches {Tribolium castaneum [TaxId: 7070]} ispeqeelihrlvyfqneyehpseedvkriindgedqcdvrfrhiteitiltvqlivefa krlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqpysrdsynlagmg etiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiqeiylealrayvd nrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflaeiwdvd
Timeline for d2nxxf_: