Lineage for d1dvba1 (1dvb A:1-147)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264975Protein Rubrerythrin, N-terminal domain [47242] (2 species)
  7. 1264976Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries)
    Uniprot P24931
  8. 1264983Domain d1dvba1: 1dvb A:1-147 [16645]
    Other proteins in same PDB: d1dvba2
    complexed with fe, zn

Details for d1dvba1

PDB Entry: 1dvb (more details), 1.9 Å

PDB Description: rubrerythrin
PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d1dvba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvba1 a.25.1.1 (A:1-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
mkslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrl
fkfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarv
fasiavaeefhekrfldfarnikegrv

SCOPe Domain Coordinates for d1dvba1:

Click to download the PDB-style file with coordinates for d1dvba1.
(The format of our PDB-style files is described here.)

Timeline for d1dvba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dvba2