Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Rubrerythrin, N-terminal domain [47242] (2 species) |
Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries) Uniprot P24931 |
Domain d1dvba1: 1dvb A:1-147 [16645] Other proteins in same PDB: d1dvba2 complexed with fe, zn |
PDB Entry: 1dvb (more details), 1.9 Å
SCOPe Domain Sequences for d1dvba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dvba1 a.25.1.1 (A:1-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} mkslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrl fkfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarv fasiavaeefhekrfldfarnikegrv
Timeline for d1dvba1: