Lineage for d2nxxb_ (2nxx B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729951Species Tribolium castaneum [TaxId:7070] [188215] (1 PDB entry)
  8. 2729953Domain d2nxxb_: 2nxx B: [166449]
    automated match to d1fbya_
    complexed with p1a

Details for d2nxxb_

PDB Entry: 2nxx (more details), 2.75 Å

PDB Description: crystal structure of the ligand-binding domains of the t.castaneum (coleoptera) heterodimer ecrusp bound to ponasterone a
PDB Compounds: (B:) Ultraspiracle (USP, NR2B4)

SCOPe Domain Sequences for d2nxxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxxb_ a.123.1.1 (B:) automated matches {Tribolium castaneum [TaxId: 7070]}
qadmpleriieaekrvecndplvalvvnennttvnnicqathkqlfqlvqwaklvphfts
lpltdqvqllragwnelliaafshrsmqaqdaivlatgltvnkstahavgvgniydrvls
elvnkmkemkmdktelgclraiilynpdvrgiksvqevemlrekiygvleeytrtthpne
pgrfaklllrlpalrsiglkclehlfffkligdvpidtflmemlegtt

SCOPe Domain Coordinates for d2nxxb_:

Click to download the PDB-style file with coordinates for d2nxxb_.
(The format of our PDB-style files is described here.)

Timeline for d2nxxb_: