Lineage for d2nxqb_ (2nxq B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711007Protein EHCABP [69021] (1 species)
  7. 2711008Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [69022] (3 PDB entries)
  8. 2711010Domain d2nxqb_: 2nxq B: [166444]
    automated match to d1jfja_
    complexed with act, ca

    fragment; missing more than one-third of the common structure and/or sequence

Details for d2nxqb_

PDB Entry: 2nxq (more details), 2.4 Å

PDB Description: crystal structure of calcium binding protein 1 from entamoeba histolytica: a novel arrangement of ef hand motifs
PDB Compounds: (B:) calcium-binding protein

SCOPe Domain Sequences for d2nxqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxqb_ a.39.1.5 (B:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
aealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefakf
ygsi

SCOPe Domain Coordinates for d2nxqb_:

Click to download the PDB-style file with coordinates for d2nxqb_.
(The format of our PDB-style files is described here.)

Timeline for d2nxqb_: