![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein EHCABP [69021] (1 species) |
![]() | Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [69022] (3 PDB entries) |
![]() | Domain d2nxqb_: 2nxq B: [166444] automated match to d1jfja_ complexed with act, ca fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2nxq (more details), 2.4 Å
SCOPe Domain Sequences for d2nxqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nxqb_ a.39.1.5 (B:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} aealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefakf ygsi
Timeline for d2nxqb_: