SCOPe 2.07: Domain d2nxqb_: 2nxq B:

Lineage for d2nxqb_ (2nxq B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein EHCABP [69021] (1 species)

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [69022] (3 PDB entries)

8. Domain d2nxqb_: 2nxq B: [166444]
   automated match to d1jfja_
   complexed with act, ca

Details for d2nxqb_

PDB Entry: 2nxq, 2.4 Å

PDB Description: crystal structure of calcium binding protein 1 from entamoeba histolytica: a novel arrangement of ef hand motifs

PDB Compounds: (B:) calcium-binding protein

SCOPe Domain Sequences for d2nxqb_:

Sequence; same for both SEQRES and ATOM records:

>d2nxqb_ a.39.1.5 (B:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
aealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefakf
ygsi

Timeline for d2nxqb_:

• d2nxqb_ first appeared in SCOPe 2.01
  
• d2nxqb_ appears in SCOPe 2.06