SCOPe 2.05: Domain d2nxlb_: 2nxl B:

Lineage for d2nxlb_ (2nxl B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (48 PDB entries)

8. Domain d2nxlb_: 2nxl B: [166440]
   automated match to d1f7aa_
   complexed with po4

Details for d2nxlb_

PDB Entry: 2nxl, 2 Å

PDB Description: structure of hiv-1 protease d25n complexed with the rt-rh analogue peptide gly-ala-glu-val-phe*tyr-val-asp-gly-ala

PDB Compounds: (B:) protease retropepsin

SCOPe Domain Sequences for d2nxlb_:

Sequence; same for both SEQRES and ATOM records:

>d2nxlb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d2nxlb_:

• d2nxlb_ first appeared in SCOPe 2.01
  
• d2nxlb_ appears in SCOPe 2.04
  
• d2nxlb_ appears in SCOPe 2.06
  
• d2nxlb_ appears in the current release, SCOPe 2.08