Lineage for d1g4wr1 (1g4w R:171-290)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638179Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) (S)
    contains extra helices in the loops at one end of the bundle
  5. 638180Family a.24.11.1: Bacterial GAP domain [47234] (3 proteins)
  6. 638186Protein SptP tyrosine phosphatase [47237] (1 species)
  7. 638187Species Salmonella typhimurium [TaxId:90371] [47238] (2 PDB entries)
  8. 638189Domain d1g4wr1: 1g4w R:171-290 [16644]
    Other proteins in same PDB: d1g4wr2

Details for d1g4wr1

PDB Entry: 1g4w (more details), 2.2 Å

PDB Description: crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp
PDB Compounds: (R:) protein tyrosine phosphatase sptp

SCOP Domain Sequences for d1g4wr1:

Sequence, based on SEQRES records: (download)

>d1g4wr1 a.24.11.1 (R:171-290) SptP tyrosine phosphatase {Salmonella typhimurium [TaxId: 602]}
lldialkglkrtlpqleqmdgnslrenfqemasgngplrslmtnlqnlnkipeakqlndy
vttltniqvgvarfsqwgtcggeverwvdkastheltqavkkihviakelknvtaeleki

Sequence, based on observed residues (ATOM records): (download)

>d1g4wr1 a.24.11.1 (R:171-290) SptP tyrosine phosphatase {Salmonella typhimurium [TaxId: 602]}
lldialkglkrtlpqleqmdgnslrplrslmtnlqnlnkqlndyvttltniqvgvarfsq
weverwvdastheltqavkkihviakelknvtaeleki

SCOP Domain Coordinates for d1g4wr1:

Click to download the PDB-style file with coordinates for d1g4wr1.
(The format of our PDB-style files is described here.)

Timeline for d1g4wr1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g4wr2