SCOPe 2.07: Domain d1g4us1: 1g4u S:167-296

Lineage for d1g4us1 (1g4u S:167-296)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.11: Bacterial GAP domain [47233] (1 family)
   contains extra helices in the loops at one end of the bundle

5. Family a.24.11.1: Bacterial GAP domain [47234] (4 proteins)

6. Protein SptP tyrosine phosphatase [47237] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [47238] (2 PDB entries)

8. Domain d1g4us1: 1g4u S:167-296 [16643]
   Other proteins in same PDB: d1g4ur_, d1g4us2
   complexed with af3, gdp, mg

Details for d1g4us1

PDB Entry: 1g4u, 2.3 Å

PDB Description: crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp bound to rac1

PDB Compounds: (S:) protein tyrosine phosphatase sptp

SCOPe Domain Sequences for d1g4us1:

Sequence; same for both SEQRES and ATOM records:

>d1g4us1 a.24.11.1 (S:167-296) SptP tyrosine phosphatase {Salmonella typhimurium [TaxId: 90371]}
skqplldialkglkrtlpqleqmdgnslrenfqemasgngplrslmtnlqnlnkipeakq
lndyvttltniqvgvarfsqwgtcggeverwvdkastheltqavkkihviakelknvtae
lekieagapm

Timeline for d1g4us1:

• d1g4us1 first appeared (with stable ids) in SCOP 1.55
  
• d1g4us1 appears in SCOPe 2.06
  
• d1g4us1 appears in the current release, SCOPe 2.08