Lineage for d1he1b_ (1he1 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726514Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1727104Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) (S)
    contains extra helices in the loops at one end of the bundle
  5. 1727105Family a.24.11.1: Bacterial GAP domain [47234] (4 proteins)
  6. 1727106Protein ExoS toxin [47235] (1 species)
  7. 1727107Species Pseudomonas aeruginosa [TaxId:287] [47236] (2 PDB entries)
  8. 1727109Domain d1he1b_: 1he1 B: [16642]
    Other proteins in same PDB: d1he1c_, d1he1d_
    complexed with af3, gdp, mg, ni

Details for d1he1b_

PDB Entry: 1he1 (more details), 2 Å

PDB Description: crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac
PDB Compounds: (B:) exoenzyme s

SCOPe Domain Sequences for d1he1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1he1b_ a.24.11.1 (B:) ExoS toxin {Pseudomonas aeruginosa [TaxId: 287]}
assavvfkqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalag
iragsqveesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvm
sevallrqavesevs

SCOPe Domain Coordinates for d1he1b_:

Click to download the PDB-style file with coordinates for d1he1b_.
(The format of our PDB-style files is described here.)

Timeline for d1he1b_: