Lineage for d1he1b_ (1he1 B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2246Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies)
  4. 2438Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) (S)
  5. 2439Family a.24.11.1: Bacterial GAP domain [47234] (2 proteins)
  6. 2440Protein ExoS toxin [47235] (1 species)
  7. 2441Species Pseudomonas aeruginosa [TaxId:287] [47236] (1 PDB entry)
  8. 2443Domain d1he1b_: 1he1 B: [16642]
    Other proteins in same PDB: d1he1c_, d1he1d_

Details for d1he1b_

PDB Entry: 1he1 (more details), 2 Å

PDB Description: crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac

SCOP Domain Sequences for d1he1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1he1b_ a.24.11.1 (B:) ExoS toxin {Pseudomonas aeruginosa}
assavvfkqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalag
iragsqveesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvm
sevallrqavesevs

SCOP Domain Coordinates for d1he1b_:

Click to download the PDB-style file with coordinates for d1he1b_.
(The format of our PDB-style files is described here.)

Timeline for d1he1b_: