Lineage for d1he1b1 (1he1 B:96-229)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700261Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) (S)
    contains extra helices in the loops at one end of the bundle
  5. 2700262Family a.24.11.1: Bacterial GAP domain [47234] (4 proteins)
  6. 2700263Protein ExoS toxin [47235] (1 species)
  7. 2700264Species Pseudomonas aeruginosa [TaxId:287] [47236] (2 PDB entries)
  8. 2700266Domain d1he1b1: 1he1 B:96-229 [16642]
    Other proteins in same PDB: d1he1a2, d1he1b2, d1he1c1, d1he1c2, d1he1d1, d1he1d2
    complexed with af3, gdp, mg, ni

Details for d1he1b1

PDB Entry: 1he1 (more details), 2 Å

PDB Description: crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac
PDB Compounds: (B:) exoenzyme s

SCOPe Domain Sequences for d1he1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1he1b1 a.24.11.1 (B:96-229) ExoS toxin {Pseudomonas aeruginosa [TaxId: 287]}
ssavvfkqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalagi
ragsqveesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvms
evallrqavesevs

SCOPe Domain Coordinates for d1he1b1:

Click to download the PDB-style file with coordinates for d1he1b1.
(The format of our PDB-style files is described here.)

Timeline for d1he1b1: