![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) ![]() contains extra helices in the loops at one end of the bundle |
![]() | Family a.24.11.1: Bacterial GAP domain [47234] (4 proteins) |
![]() | Protein ExoS toxin [47235] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [47236] (2 PDB entries) |
![]() | Domain d1he1b1: 1he1 B:96-229 [16642] Other proteins in same PDB: d1he1a2, d1he1b2, d1he1c1, d1he1c2, d1he1d1, d1he1d2 complexed with af3, gdp, mg, ni |
PDB Entry: 1he1 (more details), 2 Å
SCOPe Domain Sequences for d1he1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1he1b1 a.24.11.1 (B:96-229) ExoS toxin {Pseudomonas aeruginosa [TaxId: 287]} ssavvfkqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalagi ragsqveesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvms evallrqavesevs
Timeline for d1he1b1: