SCOPe 2.08: Domain d2nxbb1: 2nxb B:24-143

Lineage for d2nxbb1 (2nxb B:24-143)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d2nxbb1: 2nxb B:24-143 [166410]
   Other proteins in same PDB: d2nxbb2
   automated match to d1jm4b_
   complexed with edo, na

Details for d2nxbb1

PDB Entry: 2nxb, 1.4 Å

PDB Description: crystal structure of human bromodomain containing protein 3 (brd3)

PDB Compounds: (B:) Bromodomain-containing protein 3

SCOPe Domain Sequences for d2nxbb1:

Sequence; same for both SEQRES and ATOM records:

>d2nxbb1 a.29.2.0 (B:24-143) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pevsnpskpgrktnqlqymqnvvvktlwkhqfawpfyqpvdaiklnlpdyhkiiknpmdm
gtikkrlennyywsasecmqdfntmftncyiynkptddivlmaqalekiflqkvaqmpqe

Timeline for d2nxbb1:

• d2nxbb1 first appeared in SCOPe 2.01, called d2nxbb_
  
• d2nxbb1 appears in SCOPe 2.07