Class a: All alpha proteins [46456] (218 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) contains extra helices in the loops at one end of the bundle |
Family a.24.11.1: Bacterial GAP domain [47234] (3 proteins) |
Protein ExoS toxin [47235] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [47236] (2 PDB entries) |
Domain d1he1a_: 1he1 A: [16641] Other proteins in same PDB: d1he1c_, d1he1d_ |
PDB Entry: 1he1 (more details), 2 Å
SCOP Domain Sequences for d1he1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1he1a_ a.24.11.1 (A:) ExoS toxin {Pseudomonas aeruginosa} assavvfkqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalag iragsqveesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvm sevallrqavesevs
Timeline for d1he1a_: