Lineage for d1he1a_ (1he1 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353428Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 353651Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) (S)
    contains extra helices in the loops at one end of the bundle
  5. 353652Family a.24.11.1: Bacterial GAP domain [47234] (3 proteins)
  6. 353653Protein ExoS toxin [47235] (1 species)
  7. 353654Species Pseudomonas aeruginosa [TaxId:287] [47236] (2 PDB entries)
  8. 353655Domain d1he1a_: 1he1 A: [16641]
    Other proteins in same PDB: d1he1c_, d1he1d_

Details for d1he1a_

PDB Entry: 1he1 (more details), 2 Å

PDB Description: crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac

SCOP Domain Sequences for d1he1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1he1a_ a.24.11.1 (A:) ExoS toxin {Pseudomonas aeruginosa}
assavvfkqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalag
iragsqveesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvm
sevallrqavesevs

SCOP Domain Coordinates for d1he1a_:

Click to download the PDB-style file with coordinates for d1he1a_.
(The format of our PDB-style files is described here.)

Timeline for d1he1a_: