SCOP 1.65: Domain d1he1a_: 1he1 A:

Lineage for d1he1a_ (1he1 A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.11: Bacterial GAP domain [47233] (1 family)
   contains extra helices in the loops at one end of the bundle

5. Family a.24.11.1: Bacterial GAP domain [47234] (3 proteins)

6. Protein ExoS toxin [47235] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [47236] (2 PDB entries)

8. Domain d1he1a_: 1he1 A: [16641]
   Other proteins in same PDB: d1he1c_, d1he1d_

Details for d1he1a_

PDB Entry: 1he1, 2 Å

PDB Description: crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac

SCOP Domain Sequences for d1he1a_:

Sequence; same for both SEQRES and ATOM records:

>d1he1a_ a.24.11.1 (A:) ExoS toxin {Pseudomonas aeruginosa}
assavvfkqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalag
iragsqveesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvm
sevallrqavesevs

Timeline for d1he1a_:

• d1he1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1he1a_ appears in SCOP 1.63
  
• d1he1a_ appears in SCOP 1.67
  
• d1he1a_ appears in the current release, SCOPe 2.08, called d1he1a1