Lineage for d1qspb_ (1qsp B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700189Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 2700197Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)
  6. 2700210Protein Phosphorelay protein ypd1 [47231] (2 species)
  7. 2700211Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47232] (6 PDB entries)
  8. 2700227Domain d1qspb_: 1qsp B: [16640]

Details for d1qspb_

PDB Entry: 1qsp (more details), 2.7 Å

PDB Description: crystal structure of the yeast phosphorelay protein ypd1
PDB Compounds: (B:) ypd1

SCOPe Domain Sequences for d1qspb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qspb_ a.24.10.2 (B:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldnl
ghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedde
eikiqvddkdensiyliliakalnqsrlefklarielskyyntnl

SCOPe Domain Coordinates for d1qspb_:

Click to download the PDB-style file with coordinates for d1qspb_.
(The format of our PDB-style files is described here.)

Timeline for d1qspb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qspa_