SCOPe 2.07: Domain d2nx1a_: 2nx1 A:

Lineage for d2nx1a_ (2nx1 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)

6. Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (5 species)

7. Species Aquifex aeolicus [TaxId:63363] [63922] (32 PDB entries)

8. Domain d2nx1a_: 2nx1 A: [166393]
   automated match to d1pe1a_
   complexed with pep, rp5

Details for d2nx1a_

PDB Entry: 2nx1, 1.8 Å

PDB Description: structural and mechanistic changes along an engineered path from metallo to non-metallo kdo8p synthase

PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d2nx1a_:

Sequence; same for both SEQRES and ATOM records:

>d2nx1a_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
ekflviagpnaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls
qlegiieaileirevaskyyeti

Timeline for d2nx1a_:

• d2nx1a_ first appeared in SCOPe 2.01
  
• d2nx1a_ appears in SCOPe 2.06
  
• d2nx1a_ appears in the current release, SCOPe 2.08