Lineage for d2nx0a_ (2nx0 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688812Species Thunnus atlanticus [TaxId:48168] [187921] (9 PDB entries)
  8. 2688820Domain d2nx0a_: 2nx0 A: [166392]
    automated match to d1myta_
    complexed with hem, no, so4

Details for d2nx0a_

PDB Entry: 2nx0 (more details), 0.95 Å

PDB Description: ferrous nitrosyl blackfin tuna myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2nx0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nx0a_ a.1.1.2 (A:) automated matches {Thunnus atlanticus [TaxId: 48168]}
adfdavlkcwgpveadyttigglvltrlfkehpetqklfpkfagiaqadiagnaavsahg
atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmqekagldagg
qtalrnvmgiiiadleanykelgfsg

SCOPe Domain Coordinates for d2nx0a_:

Click to download the PDB-style file with coordinates for d2nx0a_.
(The format of our PDB-style files is described here.)

Timeline for d2nx0a_: