Lineage for d2nwgb_ (2nwg B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016266Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1016267Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1016268Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1016491Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)
  7. 1016492Species Human (Homo sapiens) [TaxId:9606] [54151] (9 PDB entries)
  8. 1016499Domain d2nwgb_: 2nwg B: [166383]
    automated match to d1sdfa_
    complexed with h1s

Details for d2nwgb_

PDB Entry: 2nwg (more details), 2.07 Å

PDB Description: structure of cxcl12:heparin disaccharide complex
PDB Compounds: (B:) Stromal cell-derived factor 1

SCOPe Domain Sequences for d2nwgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nwgb_ d.9.1.1 (B:) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens) [TaxId: 9606]}
slsyrcpcrffeshiaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqeyle
kaln

SCOPe Domain Coordinates for d2nwgb_:

Click to download the PDB-style file with coordinates for d2nwgb_.
(The format of our PDB-style files is described here.)

Timeline for d2nwgb_: