Lineage for d2nwba1 (2nwb A:5-392)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016335Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 2016336Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. 2016346Family a.266.1.2: Indoleamine 2,3-dioxygenase-like [140963] (3 protein domains)
    Pfam PF01231; contains extra N-terminal all-alpha subdomain of similar fold to the GST C-terminal domain (47615)
  6. 2016356Protein automated matches [190585] (2 species)
    not a true protein
  7. 2016371Species Shewanella oneidensis [TaxId:211586] [187929] (1 PDB entry)
  8. 2016372Domain d2nwba1: 2nwb A:5-392 [166380]
    Other proteins in same PDB: d2nwba2, d2nwbb2
    automated match to d1zeea1
    complexed with hem

Details for d2nwba1

PDB Entry: 2nwb (more details), 2.4 Å

PDB Description: Crystal Structure of a Putative 2,3-dioxygenase (SO4414) from Shewanella oneidensis in complex with ferric heme. Northeast Structural Genomics Target SoR52.
PDB Compounds: (A:) conserved domain protein

SCOPe Domain Sequences for d2nwba1:

Sequence, based on SEQRES records: (download)

>d2nwba1 a.266.1.2 (A:5-392) automated matches {Shewanella oneidensis [TaxId: 211586]}
tynteafdewirsrfvelnsqleqlyyqqtdranvqevgtelkhtlesegrelvkallde
gntdegfdsafdllgnvglymaacrrheiteptrettsplleasalamhigasigvtprf
atahltthnrahngiykrftdlpdeklfvdyntkgilaykrasdallkiqplgishpish
dllrvtkqalqdviesnqqlfnrldtdrffycvrpyykpyrvgsvvyrganagdfaginv
idltlglcfaneasysqmlvdkflymmpedqqilrecmrrpnlmddflqakgcihqdwyq
enlklfievcelhgqtaiqhhnelvtkyiaepsvsmeqqhlakvtasgpplhvllasler
lrdrraavlrddirtryydlkklkdslr

Sequence, based on observed residues (ATOM records): (download)

>d2nwba1 a.266.1.2 (A:5-392) automated matches {Shewanella oneidensis [TaxId: 211586]}
tynteafdewirsrfvelnsqleqlyyqqtdranvqevgtelkhtlesegrelvkallde
gntdegfdsafdllgnvglymaacrrheiteptrettsplleasalamhigasigvtprf
atahltthnrahngiykrftdlpdeklfvdyntkgilaykrasdallkiqplgishpish
dllrvtkqalqdviesnqqlfnrldtdrffycvrpyykpyrvgsvvyrganagdfaginv
idltlglcfaneasysqmlvdkflymmpedqqilrecmrrpnlmddflqakgcihqdwyq
enlklfievcelhgqtaiqhhnelvtkyiaepsvsmplhvllaslerlrdrraavlrddi
rtryydlkklkdslr

SCOPe Domain Coordinates for d2nwba1:

Click to download the PDB-style file with coordinates for d2nwba1.
(The format of our PDB-style files is described here.)

Timeline for d2nwba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nwba2