| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
| Protein automated matches [190743] (4 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [187927] (1 PDB entry) |
| Domain d2nv2v_: 2nv2 V: [166378] Other proteins in same PDB: d2nv2a_, d2nv2c_, d2nv2e_, d2nv2g_, d2nv2i_, d2nv2k_, d2nv2m_, d2nv2o_, d2nv2q_, d2nv2s_, d2nv2u_, d2nv2w_ automated match to d1r9ga_ complexed with cl, edo, gln |
PDB Entry: 2nv2 (more details), 2.12 Å
SCOPe Domain Sequences for d2nv2v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nv2v_ c.23.16.1 (V:) automated matches {Bacillus subtilis [TaxId: 1423]}
mltigvlglqgavrehihaieacgaaglvvkrpeqlnevdglilpggesttmrrlidtyq
fmeplrefaaqgkpmfgtcagliilakeiagsdnphlgllnvvvernsfgrqvdsfeadl
tikgldepftgvfiraphileagenvevlsehngrivaakqgqflgcsfnpeltedhrvt
qlfvemveeykqka
Timeline for d2nv2v_: