Lineage for d2nv2f_ (2nv2 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2858751Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2858908Protein automated matches [190743] (4 species)
    not a true protein
  7. 2858909Species Bacillus subtilis [TaxId:1423] [187927] (1 PDB entry)
  8. 2858912Domain d2nv2f_: 2nv2 F: [166370]
    Other proteins in same PDB: d2nv2a_, d2nv2c_, d2nv2e_, d2nv2g_, d2nv2i_, d2nv2k_, d2nv2m_, d2nv2o_, d2nv2q_, d2nv2s_, d2nv2u_, d2nv2w_
    automated match to d1r9ga_
    complexed with cl, edo, gln

Details for d2nv2f_

PDB Entry: 2nv2 (more details), 2.12 Å

PDB Description: structure of the plp synthase complex pdx1/2 (yaad/e) from bacillus subtilis
PDB Compounds: (F:) Glutamine amidotransferase subunit pdxT

SCOPe Domain Sequences for d2nv2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nv2f_ c.23.16.1 (F:) automated matches {Bacillus subtilis [TaxId: 1423]}
mltigvlglqgavrehihaieacgaaglvvkrpeqlnevdglilpggesttmrrlidtyq
fmeplrefaaqgkpmfgtcagliilakeiagsdnphlgllnvvvernsfgrqvdsfeadl
tikgldepftgvfiraphileagenvevlsehngrivaakqgqflgcsfnpeltedhrvt
qlfvemveeyk

SCOPe Domain Coordinates for d2nv2f_:

Click to download the PDB-style file with coordinates for d2nv2f_.
(The format of our PDB-style files is described here.)

Timeline for d2nv2f_: